HPA019725

RBKS antibody from Sigma-Aldrich
DKFZp686G13268, RBSK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019725
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019725, RRID:AB_1856105
Product name
Anti-RBKS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019725
Antibody type
Polyclonal
Antigen
Ribokinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CQVVIITLGAEGCVVLSQTEPEPKHIPTEKVKAVD
TTGAGDSFVGALAFYLAYYPNLSLEDMLNRSNFIA
AVSVQAAGTQSSYPYKKDLPLTLF
Storage
-20C
Provider Type Product Number
- No reagents -