HPA002894

DNAAF2 antibody from Atlas Antibodies
C14orf104, CILD10, FLJ10563, KTU, PF13
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002894
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002894, RRID:AB_611919
Product name
Anti-DNAAF2
Provider product page
Atlas Antibodies - HPA002894
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LQGKEERVNEESHLTEKEYIEHCNTPTTDSDSSIA
VKALQIDSFGLVTCFQQESLDVSQMILGKSQQPES
KMQSEFIKEKSATCSNEEKGNLNESVITEEKETDG
DHLSSLLNKTTVHNIPGFDSIKETNMQDGSVQVIK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -