HPA002894

DNAAF2 antibody from Sigma-Aldrich
C14orf104, CILD10, FLJ10563, KTU, PF13
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002894
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002894, RRID:AB_1078316
Product name
Anti-C14orf104 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002894
Antibody type
Polyclonal
Antigen
Protein kintoun recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LQGKEERVNEESHLTEKEYIEHCNTPTTDSDSSIA
VKALQIDSFGLVTCFQQESLDVSQMILGKSQQPES
KMQSEFIKEKSATCSNEEKGNLNESVITEEKETDG
DHLSSLLNKTTVHNIPGFDSIKETNMQDGSVQVIK
Storage
-20C
Provider Type Product Number
- No reagents -