HPA024040

SUMF2 antibody from Sigma-Aldrich
DKFZp566I1024
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024040
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024040, RRID:AB_1857651
Product name
Anti-SUMF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024040
Antibody type
Polyclonal
Antigen
Sulfatase-modifying factor 2 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ATSMVQLQGGRFLMGTNSPDSRDGEGPVREATVKP
FAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVF
EDFVSDELRNKATQPMKSVLWWLP
Storage
-20C
Provider Type Product Number
- No reagents -