HPA023939

TRMT12 antibody from Sigma-Aldrich
FLJ20772, Trm12, TYW2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023939
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023939, RRID:AB_1848793
Product name
Anti-TRMT12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023939
Antibody type
Polyclonal
Antigen
tRNA wybutosine-synthesizing protein 2 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WFTQRYREYLQRQKLFDTQHRVEKMPDGSVALPVL
GETLPEQHLQELRNRVAPGSPCMLTQLPDPVPSKR
AQGCSPAQKLCLEVSRWVE
Storage
-20C
Provider Type Product Number
- No reagents -