HPA023634

TATDN1 antibody from Sigma-Aldrich
CDA11
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023634
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023634, RRID:AB_1857779
Product name
Anti-TATDN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023634
Antibody type
Polyclonal
Antigen
Putative deoxyribonuclease TATDN1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CGEFEKNNPDLYLKELLNLAENNKGKVVAIGECGL
DFDRLQFCPKDTQLKYFEKQFELSEQTKLP
Storage
-20C
Provider Type Product Number
- No reagents -