HPA013341

SLC6A1 antibody from Sigma-Aldrich
GABATHG, GABATR, GAT1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013341
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013341, RRID:AB_1849509
Product name
Anti-SLC6A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013341
Antibody type
Polyclonal
Antigen
Sodium- and chloride-dependent GABA transporter 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IYYLYNSFTTTLPWKQCDNPWNTDRCFSNYSMVNT
TNMTSAVVEFWERNMHQMTDGLDKPG
Storage
-20C
Provider Type Product Number
- No reagents -