HPA013341

antibody from Atlas Antibodies

Targeting: SLC6A1 GABATHG, GABATR, GAT1

Antibody data

Submit

Validation data

Product number: HPA013341 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA013341, RRID:AB_1849509
Product name: Anti-SLC6A1
Antibody type: Polyclonal
Reactivity: Human, Mouse, Rat
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: IYYLYNSFTTTLPWKQCDNPWNTDRCFSNYSMVNT TNMTSAVVEFWERNMHQMTDGLDKPG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SLC6A1 protein structure - HPA013341 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using HPA013341 antibody. Corresponding SLC6A1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows moderate to strong membranous positivity in neuropil of molecular layer and in Purkinje cell layer.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuropil.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human stomach shows no positivity in glandular cells as expected.
Sample type: HUMAN