Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004879-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004879-M01, RRID:AB_606673
- Product name
- NPPB monoclonal antibody (M01), clone 2D11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant NPPB.
- Antigen sequence
MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSA
SDSETSGLQEQRNHLQGKLSELQVEQTSLEPLQES
PRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPK
MVQGSGCFGRKMDRISSSSGLGCKVLRRH- Isotype
- IgG
- Antibody clone number
- 2D11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The arrhythmogenic effect of self-assembling nanopeptide hydrogel scaffolds on neonatal mouse cardiomyocytes.
Chiu YW, Chen WP, Su CC, Lee YC, Hsieh PH, Ho YL
Nanomedicine : nanotechnology, biology, and medicine 2014 Jul;10(5):1065-73
Nanomedicine : nanotechnology, biology, and medicine 2014 Jul;10(5):1065-73
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of NPPB expression in transfected 293T cell line by NPPB monoclonal antibody (M01), clone 2D11.Lane 1: NPPB transfected lysate(14.726 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of NPPB transfected lysate using anti-NPPB monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NPPB MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol