HPA004471

KIT antibody from Sigma-Aldrich
C-Kit, CD117, PBT, SCFR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004471
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004471, RRID:AB_1078431
Product name
Anti-KIT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004471
Antibody type
Polyclonal
Antigen
Mast/stem cell growth factor receptor precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWIT
EKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFL
VDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGK
PLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVD
Q
Storage
-20C
Provider Type Product Number
- No reagents -