HPA023296

ALDH7A1 antibody from Sigma-Aldrich
ATQ1, EPD, PDE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023296
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023296, RRID:AB_1844738
Product name
Anti-ALDH7A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023296
Antibody type
Polyclonal
Antigen
Alpha-aminoadipic semialdehyde dehydrogenase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHD
EVVNRLKKAYAQIRVGNPWDPNVLYGPLHTKQAVS
MFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIV
TGLGHDASIAHTETFAPILY
Storage
-20C
Provider Type Product Number
- No reagents -