HPA026832

PTPDC1 antibody from Sigma-Aldrich
FLJ37312, PTP9Q22
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026832
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026832, RRID:AB_10602917
Product name
Anti-PTPDC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026832
Antibody type
Polyclonal
Antigen
protein tyrosine phosphatase domain containing 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GMIFSNEQQFDPLWKRRNVECLQPLTHLKRRLSYS
DSDLKRAENLLEQGETPQTVPAQILVGHKPRQQKL
ISHCYIPQSPEPDLHKEALVRSTLSFWSQSKFGGL
EGLKDNGSPIFHGRIIPKEAQQSGAFSADVSGSHS
PGE
Storage
-20C
Provider Type Product Number
- No reagents -