HPA008873

CCNB2 antibody from Sigma-Aldrich
HsT17299
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008873
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008873, RRID:AB_1078604
Product name
Anti-CCNB2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008873
Antibody type
Polyclonal
Antigen
G2/mitotic-specific cyclin-B2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRV
TTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTAS
VKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDA
LLCKIEDIDNEDWENPQLC
Storage
-20C
Provider Type Product Number
- No reagents -