HPA017995

BCKDK antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017995
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017995, RRID:AB_1845309
Product name
Anti-BCKDK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017995
Antibody type
Polyclonal
Antigen
[3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLDDHKDVVTLLAEGLRESRKHIEDEKLVRYFLDK
TLTSRLGIRMLATHHLALHEDKPDFVGIICTRLSP
KKIIEKWVDFARRLCEHKYGNAPRVRINGHVAARF
PFIPMPLDY
Storage
-20C
Provider Type Product Number
- No reagents -