Antibody data

Product number
H00007791-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007791-M02, RRID:AB_733267
Product name
ZYX monoclonal antibody (M02), clone 2D1
Provider product page
Abnova Corporation - H00007791-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant ZYX.
Antigen sequence
MAAPRPSPAISVSVSAPAFYAPQEKFGPVVAPKPK
VNPFRPGDSEPPPAPGAQRAQMGRVGEIPPPPPED
FPLPPPPLAGDGDDAEGALGGAFPPPPPPIEESFP
PAPLEEEIFPSPPPPPEEEGGPEAPIPPPPQPREK
VSSIDLEIDSLSSLLDDMTKNDPFKARVSSGYVPP
PVATPFSSKSSTKPAAGGTAPLPPWKSPSSSQPLP
QVPAPAQSQTQFHVQPQPQPKPQVQLHVQSQTQPV
SLANTQPRGPPASSPAPAPKFSPVTPKFTPVASKF
SPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFT
YAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGP
LTLKEVEELEQLTQQLMQDMEHPQRQNVAVNELCG
RCHQPLARAQPAVRALGQLFHIACFTCHQCAQQLQ
GQQFYSLEGAPYCEGCYTDTLEKCNTCGEPITDRM
LRATGKAYHPHCFTCVVCARPLEGTSFIVDQANRP
HCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVA
LDKNFHMKCYECEDCGKPLSIEADDNGCFPLDGHV
LCRKCHTARAQT
Isotype
IgG
Antibody clone number
2D1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -