HPA004835

ZYX antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004835
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004835, RRID:AB_1080771
Product name
Anti-ZYX antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004835
Antibody type
Polyclonal
Antigen
Zyxin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKL
GHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHP
VPPPAQNQNQVRSPGAPGPLTLKEVEELEQLTQQL
MQDMEHPQRQNVAVNE
Storage
-20C
Provider Type Product Number
- No reagents -