Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001591-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001591-A01, RRID:AB_463570
- Product name
- CYP24A1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant CYP24A1.
- Antigen sequence
LMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINP
FAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYD
IQATDNEPVEMLHSGTLVPSRELPIAFCQR- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A naturally occurring rexinoid, honokiol, can serve as a regulator of various retinoid x receptor heterodimers.
Overexpression of ER and VDR is not sufficient to make ER-negative MDA-MB231 breast cancer cells responsive to 1alpha-hydroxyvitamin D5.
Kotani H, Tanabe H, Mizukami H, Amagaya S, Inoue M
Biological & pharmaceutical bulletin 2012;35(1):1-9
Biological & pharmaceutical bulletin 2012;35(1):1-9
Overexpression of ER and VDR is not sufficient to make ER-negative MDA-MB231 breast cancer cells responsive to 1alpha-hydroxyvitamin D5.
Peng X, Jhaveri P, Hussain-Hakimjee EA, Mehta RG
Carcinogenesis 2007 May;28(5):1000-7
Carcinogenesis 2007 May;28(5):1000-7
No comments: Submit comment
No validations: Submit validation data