Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001591-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001591-M02, RRID:AB_1111777
- Product name
- CYP24A1 monoclonal antibody (M02), clone 1E1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CYP24A1.
- Antigen sequence
LMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINP
FAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYD
IQATDNEPVEMLHSGTLVPSRELPIAFCQR- Isotype
- IgG
- Antibody clone number
- 1E1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Dysregulation of renal vitamin D metabolism in the uremic rat.
Helvig CF, Cuerrier D, Hosfield CM, Ireland B, Kharebov AZ, Kim JW, Ramjit NJ, Ryder K, Tabash SP, Herzenberg AM, Epps TM, Petkovich M
Kidney international 2010 Sep;78(5):463-72
Kidney international 2010 Sep;78(5):463-72
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CYP24A1 expression in transfected 293T cell line by CYP24A1 monoclonal antibody (M02), clone 1E1.Lane 1: CYP24A1 transfected lysate (Predicted MW: 11.11 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CYP24A1 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol