HPA018192

NLK antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018192
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018192, RRID:AB_1854525
Product name
Anti-NLK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018192
Antibody type
Polyclonal
Antigen
Serine/threonine kinase NLK recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFD
PSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTS
TGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEII
HQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQP
S
Storage
-20C
Provider Type Product Number
- No reagents -