ABIN309930

BRD4 antibody from antibodies-online
CAP, HUNK1, HUNKI, MCAP

Antibody data

Product number
ABIN309930
Provider
antibodies-online
Product name
anti-Bromodomain Containing 4 (BRD4) antibody
Provider product page
antibodies-online - ABIN309930
Antibody type
Polyclonal
Antigen
The immunogen for anti-BRD4 antibody: synthetic peptide directed towards the C terminal of human BRD4
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
EIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEK
VDVIA GSSKMKGFSS
Vial size
50 µg
Provider Type Product Number
- No reagents -