HPA015055

BRD4 antibody from Sigma-Aldrich
CAP, HUNK1, HUNKI, MCAP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015055
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015055, RRID:AB_1845435
Product name
Anti-BRD4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015055
Antibody type
Polyclonal
Antigen
Bromodomain-containing protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSP
LMIHSPQMSQFQSLTHQSPPQQNVQPKKQELRAAS
VVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPK
HPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAP
PP
Storage
-20C
Provider Type Product Number
- No reagents -