HPA011332

IGF2R antibody from Atlas Antibodies
CD222, CI-M6PR, CI-MPR, CIMPR, M6P-R, MPR1, MPR300, MPRI
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011332
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011332, RRID:AB_1846276
Product name
Anti-IGF2R
Provider product page
Atlas Antibodies - HPA011332
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CKKDIFKANKEVPCYVFDEELRKHDLNPLIKLSGA
YLVDDSDPDTSLFINVCRDIDTLRDPGSQLRACPP
GTAACLVRGHQAFDVGQPRDGLKLVRKDRLVLSYV
REEAGKLDFCDGHSPAVTITFVCPSE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -