HPA011332

IGF2R antibody from Sigma-Aldrich
CD222, CIMPR, M6P-R, MPR1, MPRI
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011332
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011332, RRID:AB_1846276
Product name
Anti-IGF2R antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011332
Antibody type
Polyclonal
Antigen
Cation-independent mannose-6-phosphate receptor precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CKKDIFKANKEVPCYVFDEELRKHDLNPLIKLSGA
YLVDDSDPDTSLFINVCRDIDTLRDPGSQLRACPP
GTAACLVRGHQAFDVGQPRDGLKLVRKDRLVLSYV
REEAGKLDFCDGHSPAVTITFVCPSE
Storage
-20C
Provider Type Product Number
- No reagents -