HPA024055

PFDN4 antibody from Atlas Antibodies
C-1, C1, PFD4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024055
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024055, RRID:AB_1855236
Product name
Anti-PFDN4
Provider product page
Atlas Antibodies - HPA024055
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQ
LQNLEDACDDIMLADDDCLMIPYQIGDVFISHSQE
ETQEMLEEAKKNLQEEIDALESRVESIQRVLADLK
VQLYAKFG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -