Antibody data

Product number
H00005203-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005203-M03, RRID:AB_10970120
Product name
PFDN4 monoclonal antibody (M03), clone 2G4
Provider product page
Abnova Corporation - H00005203-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant PFDN4.
Antigen sequence
MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITE
LKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQ
IGDVFISHSQEETQEMLEEAKKNLQEEIDALESRV
ESIQRVLADLKVQLYAKFGSNINLEADES
Isotype
IgG
Antibody clone number
2G4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -