HPA024055

PFDN4 antibody from Sigma-Aldrich
C-1, C1, PFD4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024055
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024055, RRID:AB_1855236
Product name
Anti-PFDN4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024055
Antibody type
Polyclonal
Antigen
Prefoldin subunit 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQ
LQNLEDACDDIMLADDDCLMIPYQIGDVFISHSQE
ETQEMLEEAKKNLQEEIDALESRVESIQRVLADLK
VQLYAKFG
Storage
-20C
Provider Type Product Number
- No reagents -