HPA006299

KRT2 antibody from Sigma-Aldrich
KRT2A, KRTE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006299
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006299, RRID:AB_1079180
Product name
Anti-KRT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006299
Antibody type
Polyclonal
Antigen
Keratin, type II cytoskeletal 2 epidermal recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YMIKVELQSKVDLLNQEIEFLKVLYDAEISQIHQS
VTDTNVILSMDNSRNLDLDSIIAEVKAQYEEIAQR
SKEEAEALYHSKYEELQVTVGRHGDSLKEIKIEIS
ELNRVIQRLQGEIAHVKKQCKNVQD
Storage
-20C
Provider Type Product Number
- No reagents -