HPA016507

PAQR5 antibody from MilliporeSigma / Merck KGaA
FLJ20190, MPRG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016507
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA016507, RRID:AB_1854963
Product name
Anti-PAQR5 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA016507
Antibody type
Polyclonal
Antigen
Membrane progestin receptor gamma recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VILATHMQMEAILLDKTLRKEWLLATSKPFSFSQ
Storage
-20C
Provider Type Product Number
- No reagents -