HPA021376

IFT20 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021376
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021376, RRID:AB_1851460
Product name
Anti-IFT20 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021376
Antibody type
Polyclonal
Antigen
Intraflagellar transport protein 20 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MTHLLLTATVTPSEQNSSREPGWETAMAKDILGEA
GLHFDELNKLRVLDPEVTQQTIELKEECKDFVDK
Storage
-20C
Provider Type Product Number
- No reagents -