HPA004689

ARHGAP1 antibody from Sigma-Aldrich
CDC42GAP, p50rhoGAP, RhoGAP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004689
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004689, RRID:AB_1078194
Product name
Anti-ARHGAP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004689
Antibody type
Polyclonal
Antigen
ρ GTPase-activating protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSSS
PELVTHLKWDDPYYDIARHQIVEVAGDDKYGRKII
VFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDYT
LLYLHHGLTSDNKPSLS
Storage
-20C
Provider Type Product Number
- No reagents -