HPA004160

NEMF antibody from Sigma-Aldrich
FLJ10051, NY-CO-1, SDCCAG1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004160
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004160, RRID:AB_1079884
Product name
Anti-SDCCAG1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004160
Antibody type
Polyclonal
Antigen
Serologically defined colon cancer antigen 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KPRGGQRVSDNIKKETPFLEVITHELQDFAVDDPH
DDKEEQDLDQQGNEENLFDSLTGQPHPEDVLLFAI
PICAPYTTMTNYKYKVKLTPGVQKKGKAAKTALNS
FMHSKEATAREKDLFRSVKDTDLSRNI
Storage
-20C
Provider Type Product Number
- No reagents -