Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA026876 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-MEGF10
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
NGGTCDAATGQCHCSPGYTGERCQDECPVGTYGVL
CAETCQCVNGGKCYHVSGACLCEAGFAGERCEARL
CPEGLYGIKCDKRCPCHLENTHSCHPMSGECACKP
GWSGLYCNETCSPGFYGEACQQICSCQNGADCDSV
TGKCTCA- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Genome‐wide DNA methylation analysis identifies MEGF10 as a novel epigenetically repressed candidate tumor suppressor gene in neuroblastoma
Identification of a novel set of genes reflecting different in vivo invasive patterns of human GBM cells
Charlet J, Tomari A, Dallosso A, Szemes M, Kaselova M, Curry T, Almutairi B, Etchevers H, McConville C, Malik K, Brown K
Molecular Carcinogenesis 2016;56(4):1290-1301
Molecular Carcinogenesis 2016;56(4):1290-1301
Identification of a novel set of genes reflecting different in vivo invasive patterns of human GBM cells
Monticone M, Daga A, Candiani S, Romeo F, Mirisola V, Viaggi S, Melloni I, Pedemonte S, Zona G, Giaretti W, Pfeffer U, Castagnola P
BMC Cancer 2012;12(1)
BMC Cancer 2012;12(1)
No comments: Submit comment
No validations: Submit validation data