HPA004691

DDX10 antibody from Sigma-Aldrich
HRH-J8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004691
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004691, RRID:AB_1078629
Product name
Anti-DDX10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004691
Antibody type
Polyclonal
Antigen
Probable ATP-dependent RNA helicase DDX10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KVPVKEIKINPEKLIDVQKKLESILAQDQDLKERA
QRCFVSYVRSVYLMKDKEVFDVSKLPIPEYALSLG
LAVAPRVRFLQKMQKQPTKELVRSQADKVIEPRAP
SLTNDEVEEFRAYFNEKMSILQKGGKRLEGTEHRQ
DNDTGNEE
Storage
-20C
Provider Type Product Number
- No reagents -