Antibody data

Product number
PAB21598
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21598, RRID:AB_10965602
Product name
GSDMC polyclonal antibody
Provider product page
Abnova Corporation - PAB21598
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human GSDMC.
Reactivity
Human
Host
Rabbit
Antigen sequence
QIVTIPSPNLEDFQKRKLLDPEPSFLKECRRRGDN
LYVVTEAVELINNTVLYDSSSVNILGKIALWITYG
KG
Isotype
IgG
Vial size
100 uL
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -