HPA024767

GSDMC antibody from Sigma-Aldrich
MLZE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024767
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024767, RRID:AB_1854007
Product name
Anti-GSDMC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024767
Antibody type
Polyclonal
Antigen
Gasdermin-C recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSATKLRQFVILRKKKDSRSSFWEQSDYVPVEFSL
NDILEPSSSVLETVVTGPFHFSDIMIQKHKADMGV
NVGIEVSVSGEASVDHGCSL
Storage
-20C
Provider Type Product Number
- No reagents -