Antibody data

Product number
ABIN501364
Provider
antibodies-online
Product name
anti-Glutamate Receptor, Ionotropic, N-Methyl D-Aspartate 2a (GRIN2A) antibody
Provider product page
antibodies-online - ABIN501364
Antibody type
Polyclonal
Antigen
The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A
Reactivity
Human, Mouse
Host
Rabbit
Antigen sequence
DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPD
PYQDP SENFRKGDST
Vial size
50 µg
Provider Type Product Number
- No reagents -