Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00493829-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00493829-M04, RRID:AB_1577803
- Product name
- TRIM72 monoclonal antibody (M04), clone 2B8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant LOC493829.
- Antigen sequence
QGLWLLGLREGKILEAHVEAKEPRALRSPERRPTR
IGLYLSFGDGVLSFYDASDADALVPLFAFHERLPR
PVYPFFDVCWHDKGKNAQPLLLVGPEGAEA- Isotype
- IgG
- Antibody clone number
- 2B8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Lack of MG53 in human heart precludes utility as a biomarker of myocardial injury or endogenous cardioprotective factor.
Lemckert FA, Bournazos A, Eckert DM, Kenzler M, Hawkes JM, Butler TL, Ceely B, North KN, Winlaw DS, Egan JR, Cooper ST
Cardiovascular research 2016 May 15;110(2):178-87
Cardiovascular research 2016 May 15;110(2):178-87
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TRIM72 monoclonal antibody (M04), clone 2B8. Western Blot analysis of TRIM72 expression in HepG2.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TRIM72 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of TRIM72 transfected lysate using anti-TRIM72 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with TRIM72 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol