Antibody data

Product number
H00493829-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00493829-M04, RRID:AB_1577803
Product name
TRIM72 monoclonal antibody (M04), clone 2B8
Provider product page
Abnova Corporation - H00493829-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant LOC493829.
Antigen sequence
QGLWLLGLREGKILEAHVEAKEPRALRSPERRPTR
IGLYLSFGDGVLSFYDASDADALVPLFAFHERLPR
PVYPFFDVCWHDKGKNAQPLLLVGPEGAEA
Isotype
IgG
Antibody clone number
2B8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -