Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00493829-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00493829-M01, RRID:AB_1716470
- Product name
- TRIM72 monoclonal antibody (M01), clone 2G1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TRIM72.
- Antigen sequence
QGLWLLGLREGKILEAHVEAKEPRALRSPERRPTR
IGLYLSFGDGVLSFYDASDADALVPLFAFHERLPR
PVYPFFDVCWHDKGKNAQPLLLVGPEGAEA- Isotype
- IgG
- Antibody clone number
- 2G1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TRIM72 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of TRIM72 transfected lysate using anti-TRIM72 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with TRIM72 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol