HPA023122

TRIM72 antibody from Sigma-Aldrich
MG53
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023122
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023122, RRID:AB_1858323
Product name
Anti-TRIM72 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023122
Antibody type
Polyclonal
Antigen
Tripartite motif-containing protein 72 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LKTQLPQQKLQLQEACMRKEKSVAVLEHQLVEVEE
TVRQFRGAVGEQLGKMRVFLAALEGSLDREAERVR
GE
Storage
-20C
Provider Type Product Number
- No reagents -