HPA005449

SLC2A5 antibody from Sigma-Aldrich
GLUT5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005449
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005449, RRID:AB_1078985
Product name
Anti-SLC2A5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005449
Antibody type
Polyclonal
Antigen
Solute carrier family 2, facilitated glucose transporter member 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KALQTLRGWDSVDREVAEIRQEDEAEKAAGFISVL
KLFRMRSLRWQ
Storage
-20C
Provider Type Product Number
- No reagents -