Explore
Validate
Learn
Western blot
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PA1-28304 - Provider product page
- Provider
- Invitrogen Antibodies
- Product name
- Anti-SARM Polyclonal Antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide
- Description
- PA1-28319 detects CCL4 from human samples. PA1-28319 has been successfully used in Western blot applications. The PA1-28319 immunogen is: Synthetic peptide: GSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN, corresponding to amino acids 27-92 of Human Macrophage Inflammatory Protein 1 beta.
- Reactivity
- Human
- Host
- Rabbit
- Isotype
- IgG
- Vial size
- 50 µg
- Concentration
- 1 mg/ml
- Storage
- Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
No comments: Submit comment
Supportive validation
- Submitted by
- Invitrogen Antibodies (provider)
- Main image
- Experimental details
- Immunocytochemical analysis of SARM in Daudi cells using a SARM polyclonal antibody (Product # PA1-28304) at a dilution of 2µg/ml.
