HPA008216

SEC23B antibody from Sigma-Aldrich
CDA-II, CDAII, CDAN2, HEMPAS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008216
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008216, RRID:AB_1079895
Product name
Anti-SEC23B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008216
Antibody type
Polyclonal
Antigen
Protein transport protein Sec23B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MVQVHELSCEGISKSYVFRGTKDLTAKQIQDMLGL
TKPAMPMQQARPAQPQEHPFASSRFLQPVHKIDMN
LTDLLGELQRDPWPVTQGKRPLRSTGV
Storage
-20C
Provider Type Product Number
- No reagents -