Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310505 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 2 (SLC12A2) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC12A2 antibody: synthetic peptide directed towards the C terminal of human SLC12A2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
IIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRIT
DNELE LYKTKTYRQI- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Impaired maturation of cortical GABA(A) receptor expression in pediatric epilepsy.
Quantitative proteome analysis of HCC cell lines with different metastatic potentials by SILAC.
Na+/K+/Cl- cotransporter activates MAP-kinase cascade downstream to protein kinase C, and upstream to MEK.
Jansen LA, Peugh LD, Roden WH, Ojemann JG
Epilepsia 2010 Aug;51(8):1456-67
Epilepsia 2010 Aug;51(8):1456-67
Quantitative proteome analysis of HCC cell lines with different metastatic potentials by SILAC.
Chen N, Sun W, Deng X, Hao Y, Chen X, Xing B, Jia W, Ma J, Wei H, Zhu Y, Qian X, Jiang Y, He F
Proteomics 2008 Dec;8(23-24):5108-18
Proteomics 2008 Dec;8(23-24):5108-18
Na+/K+/Cl- cotransporter activates MAP-kinase cascade downstream to protein kinase C, and upstream to MEK.
Panet R, Eliash M, Atlan H
Journal of cellular physiology 2006 Mar;206(3):578-85
Journal of cellular physiology 2006 Mar;206(3):578-85
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- WB Suggested Anti-SLC12A2 Antibody Titration: 5.0 μg/mL ELISA Titer: 1:1562500 Positive Control: DLD1 cell lysate SLC12A2 is supported by BioGPS gene expression data to be expressed in DLD1