ABIN633453

antibody from antibodies-online

Targeting: LARP6 acheron, FLJ11196

Western blot

Antibody data

Submit

Validation data

Product number: ABIN633453 - Provider product page
Provider: antibodies-online
Product name: anti-La Ribonucleoprotein Domain Family, Member 6 (LARP6) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: LARP6 antibody was raised using the middle region of LARP6 corresponding to a region with amino acids MGTQEKSPGTSPLLSRKMQTADGLPVGVLRLPRGPDNTRGFHGHERSRAC
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

LARP6 protein structure - ABIN633453 shown in red.