Antibody data
- Antibody Data
- Antigen structure
- References [8]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055323-B01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055323-B01P, RRID:AB_1575572
- Product name
- LARP6 purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human LARP6 protein.
- Antigen sequence
MAQSGGEARPGPKTAVQIRVAIQEAEDVDELEDEE
EGAETRGAGDPARYLSPGWGSASEEEPSRGHSGTT
ASGGENEREDLEQEWKPPDEELIKKLVDQIEFYFS
DENLEKDAFLLKHVRRNKLGYVSVKLLTSFKKVKH
LTRDWRTTAHALKYSVVLELNEDHRKVRRTTPVPL
FPNENLPSKMLLVYDLYLSPKLWALATPQKNGRVQ
EKVMEHLLKLFGTFGVISSVRILKPGRELPPDIRR
ISSRYSQVGTQECAIVEFEEVEAAIKAHEFMITES
QGKENMKAVLIGMKPPKKKPAKDKNHDEEPTASIH
LNKSLNKRVEELQYMGDESSANSSSDPESNPTSPM
AGRRHAATNKLSPSGHQNLFLSPNASPCTSPWSSP
LAQRKGVSRKSPLAEEGRLNCSTSPEIFRKCMDYS
SDSSVTPSGSPWVRRRRQAEMGTQEKSPGTSPLLS
RKMQTADGLPVGVLRLPRGPDNTRGFHGHERSRAC
V- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Role of LARP6 and nonmuscle myosin in partitioning of collagen mRNAs to the ER membrane.
Insulin-like growth factor-1 increases synthesis of collagen type I via induction of the mRNA-binding protein LARP6 expression and binding to the 5' stem-loop of COL1a1 and COL1a2 mRNA.
Tacrolimus (FK506) prevents early stages of ethanol induced hepatic fibrosis by targeting LARP6 dependent mechanism of collagen synthesis.
Serine-threonine kinase receptor-associated protein (STRAP) regulates translation of type I collagen mRNAs.
A novel role of RNA helicase A in regulation of translation of type I collagen mRNAs.
A novel role of vimentin filaments: binding and stabilization of collagen mRNAs.
Binding of LARP6 to the conserved 5' stem-loop regulates translation of mRNAs encoding type I collagen.
Nonmuscle myosin-dependent synthesis of type I collagen.
Wang H, Stefanovic B
PloS one 2014;9(10):e108870
PloS one 2014;9(10):e108870
Insulin-like growth factor-1 increases synthesis of collagen type I via induction of the mRNA-binding protein LARP6 expression and binding to the 5' stem-loop of COL1a1 and COL1a2 mRNA.
Blackstock CD, Higashi Y, Sukhanov S, Shai SY, Stefanovic B, Tabony AM, Yoshida T, Delafontaine P
The Journal of biological chemistry 2014 Mar 14;289(11):7264-74
The Journal of biological chemistry 2014 Mar 14;289(11):7264-74
Tacrolimus (FK506) prevents early stages of ethanol induced hepatic fibrosis by targeting LARP6 dependent mechanism of collagen synthesis.
Manojlovic Z, Blackmon J, Stefanovic B
PloS one 2013;8(6):e65897
PloS one 2013;8(6):e65897
Serine-threonine kinase receptor-associated protein (STRAP) regulates translation of type I collagen mRNAs.
Vukmirovic M, Manojlovic Z, Stefanovic B
Molecular and cellular biology 2013 Oct;33(19):3893-906
Molecular and cellular biology 2013 Oct;33(19):3893-906
A novel role of RNA helicase A in regulation of translation of type I collagen mRNAs.
Manojlovic Z, Stefanovic B
RNA (New York, N.Y.) 2012 Feb;18(2):321-34
RNA (New York, N.Y.) 2012 Feb;18(2):321-34
A novel role of vimentin filaments: binding and stabilization of collagen mRNAs.
Challa AA, Stefanovic B
Molecular and cellular biology 2011 Sep;31(18):3773-89
Molecular and cellular biology 2011 Sep;31(18):3773-89
Binding of LARP6 to the conserved 5' stem-loop regulates translation of mRNAs encoding type I collagen.
Cai L, Fritz D, Stefanovic L, Stefanovic B
Journal of molecular biology 2010 Jan 15;395(2):309-26
Journal of molecular biology 2010 Jan 15;395(2):309-26
Nonmuscle myosin-dependent synthesis of type I collagen.
Cai L, Fritz D, Stefanovic L, Stefanovic B
Journal of molecular biology 2010 Aug 27;401(4):564-78
Journal of molecular biology 2010 Aug 27;401(4):564-78
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of LARP6 expression in transfected 293T cell line (H00055323-T02) by LARP6 MaxPab polyclonal antibody.Lane 1: LARP6 transfected lysate(54.01 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of purified MaxPab antibody to LARP6 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol