Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009058-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009058-A01, RRID:AB_714855
- Product name
- SLC13A2 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant SLC13A2.
- Antigen sequence
AMMVPIAHAVLDQLHSSQASSNVEEGSNNPTFELQ
EPSPQKEVTKLDNGQALPVTSASSEGRAHLSQKHL
HLTQC- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Synthesis, maturation, and trafficking of human Na+-dicarboxylate cotransporter NaDC1 requires the chaperone activity of cyclophilin B.
Bergeron MJ, Bürzle M, Kovacs G, Simonin A, Hediger MA
The Journal of biological chemistry 2011 Apr 1;286(13):11242-53
The Journal of biological chemistry 2011 Apr 1;286(13):11242-53
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SLC13A2 polyclonal antibody (A01), Lot # 061130JCS1 Western Blot analysis of SLC13A2 expression in MCF-7 ( Cat # L046V1 ).