HPA014963

SLC13A2 antibody from Sigma-Aldrich
NaDC-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014963
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014963, RRID:AB_1857096
Product name
Anti-SLC13A2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014963
Antibody type
Polyclonal
Antigen
Solute carrier family 13 member 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ATSAMMVPIAHAVLDQLHSSQASSNVEEGSNNPTF
ELQEPSPQKEVTKLDNGQALPVTSASSEGRAHLSQ
KHLHLTQCMSLCVCYSASIGGIATLTGTAPNLVLQ
GQINSLFPQNGNVV
Storage
-20C
Provider Type Product Number
- No reagents -