HPA007884

ABCA3 antibody from Sigma-Aldrich
ABC-C, ABC3, EST111653, LBM180
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007884
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007884, RRID:AB_1078077
Product name
Anti-ABCA3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007884
Antibody type
Polyclonal
Antigen
ATP-binding cassette sub-family A member 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MLRLTLGEYGRTVVPFSVPGTSQLGQQLSEHLKDA
LQAEGQEPREVLGDLEEFLIFRASVEGGGFNERCL
VAASFRDVGERTVVNALFNNQAYHSPATALAVVDN
LLFKLLCGPHASIVVSNFPQPRSALQAAKDQFNEG
Storage
-20C
Provider Type Product Number
- No reagents -