H00023017-M10

FAIM2 antibody from Abnova Corporation
KIAA0950, LFG, LFG2, LIFEGUARD, NMP35, TMBIM2

Antibody data

Product number
H00023017-M10
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023017-M10, RRID:AB_1237700
Product name
FAIM2 monoclonal antibody (M10), clone 2C2
Provider product page
Abnova Corporation - H00023017-M10
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant FAIM2.
Antigen sequence
MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAP
PSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVDP
SSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRK
VYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGW
YWASYAVFFATYLTLACCSGPRRHFPWNLILLTVF
TLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVT
VFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILL
PFQYVPWLHAVYAALGAGVFTLFLALDTQLLMGNR
RHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNR
E
Isotype
IgG
Antibody clone number
2C2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -