HPA018790

FAIM2 antibody from Sigma-Aldrich
KIAA0950, LFG, LFG2, LIFEGUARD, NMP35, TMBIM2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018790
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018790, RRID:AB_1852822
Product name
Anti-FAIM2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018790
Antibody type
Polyclonal
Antigen
Fas apoptotic inhibitory molecule 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAP
PSYEEATSGE
Storage
-20C
Provider Type Product Number
- No reagents -